Protein Description: 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) like
Gene Name: ACCSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075023: 46%, ENSRNOG00000042533: 49%
Entrez Gene ID: 390110
Uniprot ID: Q4AC99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACCSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075023: 46%, ENSRNOG00000042533: 49%
Entrez Gene ID: 390110
Uniprot ID: Q4AC99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT |
| Documents & Links for Anti ACCSL pAb (ATL-HPA065042) | |
| Datasheet | Anti ACCSL pAb (ATL-HPA065042) Datasheet (External Link) |
| Vendor Page | Anti ACCSL pAb (ATL-HPA065042) at Atlas |
| Documents & Links for Anti ACCSL pAb (ATL-HPA065042) | |
| Datasheet | Anti ACCSL pAb (ATL-HPA065042) Datasheet (External Link) |
| Vendor Page | Anti ACCSL pAb (ATL-HPA065042) |