Anti ACCSL pAb (ATL-HPA065042)

Catalog No:
ATL-HPA065042-25
$447.00

Description

Product Description

Protein Description: 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) like
Gene Name: ACCSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075023: 46%, ENSRNOG00000042533: 49%
Entrez Gene ID: 390110
Uniprot ID: Q4AC99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT
Gene Sequence ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT
Gene ID - Mouse ENSMUSG00000075023
Gene ID - Rat ENSRNOG00000042533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ACCSL pAb (ATL-HPA065042)
Datasheet Anti ACCSL pAb (ATL-HPA065042) Datasheet (External Link)
Vendor Page Anti ACCSL pAb (ATL-HPA065042) at Atlas Antibodies

Documents & Links for Anti ACCSL pAb (ATL-HPA065042)
Datasheet Anti ACCSL pAb (ATL-HPA065042) Datasheet (External Link)
Vendor Page Anti ACCSL pAb (ATL-HPA065042)

Product Description

Protein Description: 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) like
Gene Name: ACCSL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075023: 46%, ENSRNOG00000042533: 49%
Entrez Gene ID: 390110
Uniprot ID: Q4AC99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT
Gene Sequence ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT
Gene ID - Mouse ENSMUSG00000075023
Gene ID - Rat ENSRNOG00000042533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ACCSL pAb (ATL-HPA065042)
Datasheet Anti ACCSL pAb (ATL-HPA065042) Datasheet (External Link)
Vendor Page Anti ACCSL pAb (ATL-HPA065042) at Atlas Antibodies

Documents & Links for Anti ACCSL pAb (ATL-HPA065042)
Datasheet Anti ACCSL pAb (ATL-HPA065042) Datasheet (External Link)
Vendor Page Anti ACCSL pAb (ATL-HPA065042)