Protein Description: acyl-CoA dehydrogenase, very long chain
Gene Name: ACADVL
Alternative Gene Name: ACAD6, LCACD, VLCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018574: 85%, ENSRNOG00000018114: 85%
Entrez Gene ID: 37
Uniprot ID: P49748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACADVL
Alternative Gene Name: ACAD6, LCACD, VLCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018574: 85%, ENSRNOG00000018114: 85%
Entrez Gene ID: 37
Uniprot ID: P49748
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQI |
Documents & Links for Anti ACADVL pAb (ATL-HPA020595 w/enhanced validation) | |
Datasheet | Anti ACADVL pAb (ATL-HPA020595 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACADVL pAb (ATL-HPA020595 w/enhanced validation) at Atlas |
Documents & Links for Anti ACADVL pAb (ATL-HPA020595 w/enhanced validation) | |
Datasheet | Anti ACADVL pAb (ATL-HPA020595 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACADVL pAb (ATL-HPA020595 w/enhanced validation) |