Anti ACADSB pAb (ATL-HPA063555 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA063555-100

• 
• 

Product Description

Protein Description: acyl-CoA dehydrogenase short/branched chain
Gene Name: ACADSB
Alternative Gene Name: ACAD7, SBCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030861: 80%, ENSRNOG00000020624: 81%
Entrez Gene ID: 36
Uniprot ID: P45954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQN
• Gene Sequence: EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCEIQN
• Gene ID - Mouse: ENSMUSG00000030861
• Gene ID - Rat: ENSRNOG00000020624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.