![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99993/179734/atl-hpa067222_anti-acad10-pab-atl-hpa067222_61396__25959.1681135495.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: acyl-CoA dehydrogenase family, member 10
Gene Name: ACAD10
Alternative Gene Name: MGC5601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029456: 62%, ENSRNOG00000037815: 61%
Entrez Gene ID: 80724
Uniprot ID: Q6JQN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACAD10
Alternative Gene Name: MGC5601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029456: 62%, ENSRNOG00000037815: 61%
Entrez Gene ID: 80724
Uniprot ID: Q6JQN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN |
| Documents & Links for Anti ACAD10 pAb (ATL-HPA067222) | |
| Datasheet | Anti ACAD10 pAb (ATL-HPA067222) Datasheet (External Link) |
| Vendor Page | Anti ACAD10 pAb (ATL-HPA067222) at Atlas |
| Documents & Links for Anti ACAD10 pAb (ATL-HPA067222) | |
| Datasheet | Anti ACAD10 pAb (ATL-HPA067222) Datasheet (External Link) |
| Vendor Page | Anti ACAD10 pAb (ATL-HPA067222) |