Anti ACAD10 pAb (ATL-HPA067222)

Catalog No:
ATL-HPA067222-25
$303.00

Description

Product Description

Protein Description: acyl-CoA dehydrogenase family, member 10
Gene Name: ACAD10
Alternative Gene Name: MGC5601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029456: 62%, ENSRNOG00000037815: 61%
Entrez Gene ID: 80724
Uniprot ID: Q6JQN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN
Gene Sequence MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN
Gene ID - Mouse ENSMUSG00000029456
Gene ID - Rat ENSRNOG00000037815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ACAD10 pAb (ATL-HPA067222)
Datasheet Anti ACAD10 pAb (ATL-HPA067222) Datasheet (External Link)
Vendor Page Anti ACAD10 pAb (ATL-HPA067222) at Atlas Antibodies

Documents & Links for Anti ACAD10 pAb (ATL-HPA067222)
Datasheet Anti ACAD10 pAb (ATL-HPA067222) Datasheet (External Link)
Vendor Page Anti ACAD10 pAb (ATL-HPA067222)

Product Description

Protein Description: acyl-CoA dehydrogenase family, member 10
Gene Name: ACAD10
Alternative Gene Name: MGC5601
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029456: 62%, ENSRNOG00000037815: 61%
Entrez Gene ID: 80724
Uniprot ID: Q6JQN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN
Gene Sequence MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMGGVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGEN
Gene ID - Mouse ENSMUSG00000029456
Gene ID - Rat ENSRNOG00000037815
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ACAD10 pAb (ATL-HPA067222)
Datasheet Anti ACAD10 pAb (ATL-HPA067222) Datasheet (External Link)
Vendor Page Anti ACAD10 pAb (ATL-HPA067222) at Atlas Antibodies

Documents & Links for Anti ACAD10 pAb (ATL-HPA067222)
Datasheet Anti ACAD10 pAb (ATL-HPA067222) Datasheet (External Link)
Vendor Page Anti ACAD10 pAb (ATL-HPA067222)