Protein Description: activator of basal transcription 1
Gene Name: ABT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036376: 88%, ENSRNOG00000017585: 89%
Entrez Gene ID: 29777
Uniprot ID: Q9ULW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036376: 88%, ENSRNOG00000017585: 89%
Entrez Gene ID: 29777
Uniprot ID: Q9ULW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR |
Documents & Links for Anti ABT1 pAb (ATL-HPA077039) | |
Datasheet | Anti ABT1 pAb (ATL-HPA077039) Datasheet (External Link) |
Vendor Page | Anti ABT1 pAb (ATL-HPA077039) at Atlas |
Documents & Links for Anti ABT1 pAb (ATL-HPA077039) | |
Datasheet | Anti ABT1 pAb (ATL-HPA077039) Datasheet (External Link) |
Vendor Page | Anti ABT1 pAb (ATL-HPA077039) |