Anti ABT1 pAb (ATL-HPA077039)

Catalog No:
ATL-HPA077039-25
$401.00
Protein Description: activator of basal transcription 1
Gene Name: ABT1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036376: 88%, ENSRNOG00000017585: 89%
Entrez Gene ID: 29777
Uniprot ID: Q9ULW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR

Documents & Links for Anti ABT1 pAb (ATL-HPA077039)
Datasheet Anti ABT1 pAb (ATL-HPA077039) Datasheet (External Link)
Vendor Page Anti ABT1 pAb (ATL-HPA077039) at Atlas

Documents & Links for Anti ABT1 pAb (ATL-HPA077039)
Datasheet Anti ABT1 pAb (ATL-HPA077039) Datasheet (External Link)
Vendor Page Anti ABT1 pAb (ATL-HPA077039)