Protein Description: active BCR-related
Gene Name: ABR
Alternative Gene Name: MDB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017631: 91%, ENSRNOG00000056837: 86%
Entrez Gene ID: 29
Uniprot ID: Q12979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABR
Alternative Gene Name: MDB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017631: 91%, ENSRNOG00000056837: 86%
Entrez Gene ID: 29
Uniprot ID: Q12979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK |
| Gene Sequence | LYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK |
| Gene ID - Mouse | ENSMUSG00000017631 |
| Gene ID - Rat | ENSRNOG00000056837 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ABR pAb (ATL-HPA053618) | |
| Datasheet | Anti ABR pAb (ATL-HPA053618) Datasheet (External Link) |
| Vendor Page | Anti ABR pAb (ATL-HPA053618) at Atlas Antibodies |
| Documents & Links for Anti ABR pAb (ATL-HPA053618) | |
| Datasheet | Anti ABR pAb (ATL-HPA053618) Datasheet (External Link) |
| Vendor Page | Anti ABR pAb (ATL-HPA053618) |