Anti ABL2 pAb (ATL-HPA072754)

Catalog No:
ATL-HPA072754-25
$395.00

Description

Product Description

Protein Description: ABL proto-oncogene 2, non-receptor tyrosine kinase
Gene Name: ABL2
Alternative Gene Name: ABLL, ARG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026596: 86%, ENSRNOG00000004305: 88%
Entrez Gene ID: 27
Uniprot ID: P42684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
Gene Sequence SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
Gene ID - Mouse ENSMUSG00000026596
Gene ID - Rat ENSRNOG00000004305
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ABL2 pAb (ATL-HPA072754)
Datasheet Anti ABL2 pAb (ATL-HPA072754) Datasheet (External Link)
Vendor Page Anti ABL2 pAb (ATL-HPA072754) at Atlas Antibodies

Documents & Links for Anti ABL2 pAb (ATL-HPA072754)
Datasheet Anti ABL2 pAb (ATL-HPA072754) Datasheet (External Link)
Vendor Page Anti ABL2 pAb (ATL-HPA072754)

Product Description

Protein Description: ABL proto-oncogene 2, non-receptor tyrosine kinase
Gene Name: ABL2
Alternative Gene Name: ABLL, ARG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026596: 86%, ENSRNOG00000004305: 88%
Entrez Gene ID: 27
Uniprot ID: P42684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
Gene Sequence SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
Gene ID - Mouse ENSMUSG00000026596
Gene ID - Rat ENSRNOG00000004305
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ABL2 pAb (ATL-HPA072754)
Datasheet Anti ABL2 pAb (ATL-HPA072754) Datasheet (External Link)
Vendor Page Anti ABL2 pAb (ATL-HPA072754) at Atlas Antibodies

Documents & Links for Anti ABL2 pAb (ATL-HPA072754)
Datasheet Anti ABL2 pAb (ATL-HPA072754) Datasheet (External Link)
Vendor Page Anti ABL2 pAb (ATL-HPA072754)