Description
Product Description
Protein Description: ABL proto-oncogene 2, non-receptor tyrosine kinase
Gene Name: ABL2
Alternative Gene Name: ABLL, ARG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026596: 86%, ENSRNOG00000004305: 88%
Entrez Gene ID: 27
Uniprot ID: P42684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABL2
Alternative Gene Name: ABLL, ARG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026596: 86%, ENSRNOG00000004305: 88%
Entrez Gene ID: 27
Uniprot ID: P42684
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF |
Gene Sequence | SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF |
Gene ID - Mouse | ENSMUSG00000026596 |
Gene ID - Rat | ENSRNOG00000004305 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ABL2 pAb (ATL-HPA072754) | |
Datasheet | Anti ABL2 pAb (ATL-HPA072754) Datasheet (External Link) |
Vendor Page | Anti ABL2 pAb (ATL-HPA072754) at Atlas Antibodies |
Documents & Links for Anti ABL2 pAb (ATL-HPA072754) | |
Datasheet | Anti ABL2 pAb (ATL-HPA072754) Datasheet (External Link) |
Vendor Page | Anti ABL2 pAb (ATL-HPA072754) |