Description
Product Description
Protein Description: abl-interactor 2
Gene Name: ABI2
Alternative Gene Name: ABI-2, ABI2B, AblBP3, AIP-1, argBPIA, SSH3BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026782: 94%, ENSRNOG00000017707: 51%
Entrez Gene ID: 10152
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABI2
Alternative Gene Name: ABI-2, ABI2B, AblBP3, AIP-1, argBPIA, SSH3BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026782: 94%, ENSRNOG00000017707: 51%
Entrez Gene ID: 10152
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT |
| Gene Sequence | PSSTAPDAAAGGAQTLADGFTSPTPPVVSSTPPTGHPVQFYSMNRPASRHT |
| Gene ID - Mouse | ENSMUSG00000026782 |
| Gene ID - Rat | ENSRNOG00000017707 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti ABI2 pAb (ATL-HPA062433) | |
| Datasheet | Anti ABI2 pAb (ATL-HPA062433) Datasheet (External Link) |
| Vendor Page | Anti ABI2 pAb (ATL-HPA062433) at Atlas Antibodies |
| Documents & Links for Anti ABI2 pAb (ATL-HPA062433) | |
| Datasheet | Anti ABI2 pAb (ATL-HPA062433) Datasheet (External Link) |
| Vendor Page | Anti ABI2 pAb (ATL-HPA062433) |