Description
Product Description
Protein Description: abl-interactor 1
Gene Name: ABI1
Alternative Gene Name: ABI-1, E3B1, SSH3BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058835: 98%, ENSRNOG00000031325: 100%
Entrez Gene ID: 10006
Uniprot ID: Q8IZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABI1
Alternative Gene Name: ABI-1, E3B1, SSH3BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058835: 98%, ENSRNOG00000031325: 100%
Entrez Gene ID: 10006
Uniprot ID: Q8IZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ |
Gene Sequence | SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ |
Gene ID - Mouse | ENSMUSG00000058835 |
Gene ID - Rat | ENSRNOG00000031325 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ABI1 pAb (ATL-HPA068407) | |
Datasheet | Anti ABI1 pAb (ATL-HPA068407) Datasheet (External Link) |
Vendor Page | Anti ABI1 pAb (ATL-HPA068407) at Atlas Antibodies |
Documents & Links for Anti ABI1 pAb (ATL-HPA068407) | |
Datasheet | Anti ABI1 pAb (ATL-HPA068407) Datasheet (External Link) |
Vendor Page | Anti ABI1 pAb (ATL-HPA068407) |