Anti ABI1 pAb (ATL-HPA068407)

Atlas Antibodies

Catalog No: ATL-HPA068407-25

• 

Product Description

Protein Description: abl-interactor 1
Gene Name: ABI1
Alternative Gene Name: ABI-1, E3B1, SSH3BP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058835: 98%, ENSRNOG00000031325: 100%
Entrez Gene ID: 10006
Uniprot ID: Q8IZP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ
• Gene Sequence: SQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQ
• Gene ID - Mouse: ENSMUSG00000058835
• Gene ID - Rat: ENSRNOG00000031325
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.