Protein Description: abhydrolase domain containing 6
Gene Name: ABHD6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025277: 86%, ENSRNOG00000008167: 87%
Entrez Gene ID: 57406
Uniprot ID: Q9BV23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABHD6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025277: 86%, ENSRNOG00000008167: 87%
Entrez Gene ID: 57406
Uniprot ID: Q9BV23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD |
| Documents & Links for Anti ABHD6 pAb (ATL-HPA073225) | |
| Datasheet | Anti ABHD6 pAb (ATL-HPA073225) Datasheet (External Link) |
| Vendor Page | Anti ABHD6 pAb (ATL-HPA073225) at Atlas |
| Documents & Links for Anti ABHD6 pAb (ATL-HPA073225) | |
| Datasheet | Anti ABHD6 pAb (ATL-HPA073225) Datasheet (External Link) |
| Vendor Page | Anti ABHD6 pAb (ATL-HPA073225) |