Anti ABHD14A pAb (ATL-HPA056913)

Atlas Antibodies

Catalog No: ATL-HPA056913-25

• 

Product Description

Protein Description: abhydrolase domain containing 14A
Gene Name: ABHD14A
Alternative Gene Name: DKFZP564O243, DORZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042210: 87%, ENSRNOG00000011936: 89%
Entrez Gene ID: 25864
Uniprot ID: Q9BUJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
• Gene Sequence: NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
• Gene ID - Mouse: ENSMUSG00000042210
• Gene ID - Rat: ENSRNOG00000011936
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.