Description
Product Description
Protein Description: ATP binding cassette subfamily C member 2
Gene Name: ABCC2
Alternative Gene Name: CMOAT, cMRP, DJS, MRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025194: 58%, ENSRNOG00000046727: 56%
Entrez Gene ID: 1244
Uniprot ID: Q92887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABCC2
Alternative Gene Name: CMOAT, cMRP, DJS, MRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025194: 58%, ENSRNOG00000046727: 56%
Entrez Gene ID: 1244
Uniprot ID: Q92887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR |
Gene Sequence | NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR |
Gene ID - Mouse | ENSMUSG00000025194 |
Gene ID - Rat | ENSRNOG00000046727 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) | |
Datasheet | Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) | |
Datasheet | Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) |