Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation)

Catalog No:
ATL-HPA071145-25
$395.00

Description

Product Description

Protein Description: ATP binding cassette subfamily C member 2
Gene Name: ABCC2
Alternative Gene Name: CMOAT, cMRP, DJS, MRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025194: 58%, ENSRNOG00000046727: 56%
Entrez Gene ID: 1244
Uniprot ID: Q92887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR
Gene Sequence NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR
Gene ID - Mouse ENSMUSG00000025194
Gene ID - Rat ENSRNOG00000046727
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation)
Datasheet Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation)
Datasheet Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation)

Product Description

Protein Description: ATP binding cassette subfamily C member 2
Gene Name: ABCC2
Alternative Gene Name: CMOAT, cMRP, DJS, MRP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025194: 58%, ENSRNOG00000046727: 56%
Entrez Gene ID: 1244
Uniprot ID: Q92887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR
Gene Sequence NNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVSKFETHMKRELQKARRALQRRQEKSSQQNSGAR
Gene ID - Mouse ENSMUSG00000025194
Gene ID - Rat ENSRNOG00000046727
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation)
Datasheet Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation)
Datasheet Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCC2 pAb (ATL-HPA071145 w/enhanced validation)