Protein Description: ATP binding cassette subfamily C member 1
Gene Name: ABCC1
Alternative Gene Name: GS-X, MRP, MRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023088: 75%, ENSRNOG00000022305: 73%
Entrez Gene ID: 4363
Uniprot ID: P33527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABCC1
Alternative Gene Name: GS-X, MRP, MRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023088: 75%, ENSRNOG00000022305: 73%
Entrez Gene ID: 4363
Uniprot ID: P33527
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVL |
Documents & Links for Anti ABCC1 pAb (ATL-HPA076011) | |
Datasheet | Anti ABCC1 pAb (ATL-HPA076011) Datasheet (External Link) |
Vendor Page | Anti ABCC1 pAb (ATL-HPA076011) at Atlas |
Documents & Links for Anti ABCC1 pAb (ATL-HPA076011) | |
Datasheet | Anti ABCC1 pAb (ATL-HPA076011) Datasheet (External Link) |
Vendor Page | Anti ABCC1 pAb (ATL-HPA076011) |