Protein Description: ATP-binding cassette, sub-family A (ABC1), member 6
Gene Name: ABCA6
Alternative Gene Name: EST155051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044749: 61%, ENSRNOG00000046890: 59%
Entrez Gene ID: 23460
Uniprot ID: Q8N139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABCA6
Alternative Gene Name: EST155051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044749: 61%, ENSRNOG00000046890: 59%
Entrez Gene ID: 23460
Uniprot ID: Q8N139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LEGQSTIEQDFEQVEMIRDSESLNEMELAHSSFSEMQTAVSDMGLWRMQVFAMARLRFLKL |
Documents & Links for Anti ABCA6 pAb (ATL-HPA067180) | |
Datasheet | Anti ABCA6 pAb (ATL-HPA067180) Datasheet (External Link) |
Vendor Page | Anti ABCA6 pAb (ATL-HPA067180) at Atlas |
Documents & Links for Anti ABCA6 pAb (ATL-HPA067180) | |
Datasheet | Anti ABCA6 pAb (ATL-HPA067180) Datasheet (External Link) |
Vendor Page | Anti ABCA6 pAb (ATL-HPA067180) |