Anti ABCA6 pAb (ATL-HPA064878)

Atlas Antibodies

Catalog No: ATL-HPA064878-25

• 

Product Description

Protein Description: ATP-binding cassette, sub-family A (ABC1), member 6
Gene Name: ABCA6
Alternative Gene Name: EST155051
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044749: 59%, ENSRNOG00000046890: 59%
Entrez Gene ID: 23460
Uniprot ID: Q8N139
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYFDKILPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYF
• Gene Sequence: LYFDKILPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYF
• Gene ID - Mouse: ENSMUSG00000044749
• Gene ID - Rat: ENSRNOG00000046890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.