Protein Description: ATP binding cassette subfamily A member 5
Gene Name: ABCA5
Alternative Gene Name: EST90625
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018800: 96%, ENSRNOG00000004378: 96%
Entrez Gene ID: 23461
Uniprot ID: Q8WWZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABCA5
Alternative Gene Name: EST90625
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018800: 96%, ENSRNOG00000004378: 96%
Entrez Gene ID: 23461
Uniprot ID: Q8WWZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS |
Documents & Links for Anti ABCA5 pAb (ATL-HPA062904) | |
Datasheet | Anti ABCA5 pAb (ATL-HPA062904) Datasheet (External Link) |
Vendor Page | Anti ABCA5 pAb (ATL-HPA062904) at Atlas |
Documents & Links for Anti ABCA5 pAb (ATL-HPA062904) | |
Datasheet | Anti ABCA5 pAb (ATL-HPA062904) Datasheet (External Link) |
Vendor Page | Anti ABCA5 pAb (ATL-HPA062904) |