Protein Description: ATP binding cassette subfamily A member 4
Gene Name: ABCA4
Alternative Gene Name: ABCR, ARMD2, CORD3, FFM, RP19, STGD, STGD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028125: 84%, ENSRNOG00000012892: 83%
Entrez Gene ID: 24
Uniprot ID: P78363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABCA4
Alternative Gene Name: ABCR, ARMD2, CORD3, FFM, RP19, STGD, STGD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028125: 84%, ENSRNOG00000012892: 83%
Entrez Gene ID: 24
Uniprot ID: P78363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET |
Documents & Links for Anti ABCA4 pAb (ATL-HPA078826) | |
Datasheet | Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link) |
Vendor Page | Anti ABCA4 pAb (ATL-HPA078826) at Atlas |
Documents & Links for Anti ABCA4 pAb (ATL-HPA078826) | |
Datasheet | Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link) |
Vendor Page | Anti ABCA4 pAb (ATL-HPA078826) |