Anti ABCA4 pAb (ATL-HPA078826)

Catalog No:
ATL-HPA078826-25
$395.00

Description

Product Description

Protein Description: ATP binding cassette subfamily A member 4
Gene Name: ABCA4
Alternative Gene Name: ABCR, ARMD2, CORD3, FFM, RP19, STGD, STGD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028125: 84%, ENSRNOG00000012892: 83%
Entrez Gene ID: 24
Uniprot ID: P78363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
Gene Sequence IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
Gene ID - Mouse ENSMUSG00000028125
Gene ID - Rat ENSRNOG00000012892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ABCA4 pAb (ATL-HPA078826)
Datasheet Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link)
Vendor Page Anti ABCA4 pAb (ATL-HPA078826) at Atlas Antibodies

Documents & Links for Anti ABCA4 pAb (ATL-HPA078826)
Datasheet Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link)
Vendor Page Anti ABCA4 pAb (ATL-HPA078826)

Product Description

Protein Description: ATP binding cassette subfamily A member 4
Gene Name: ABCA4
Alternative Gene Name: ABCR, ARMD2, CORD3, FFM, RP19, STGD, STGD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028125: 84%, ENSRNOG00000012892: 83%
Entrez Gene ID: 24
Uniprot ID: P78363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
Gene Sequence IQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEET
Gene ID - Mouse ENSMUSG00000028125
Gene ID - Rat ENSRNOG00000012892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ABCA4 pAb (ATL-HPA078826)
Datasheet Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link)
Vendor Page Anti ABCA4 pAb (ATL-HPA078826) at Atlas Antibodies

Documents & Links for Anti ABCA4 pAb (ATL-HPA078826)
Datasheet Anti ABCA4 pAb (ATL-HPA078826) Datasheet (External Link)
Vendor Page Anti ABCA4 pAb (ATL-HPA078826)