Anti ABCA13 pAb (ATL-HPA063601)

Atlas Antibodies

Catalog No: ATL-HPA063601-25

• 

Product Description

Protein Description: ATP-binding cassette, sub-family A (ABC1), member 13
Gene Name: ABCA13
Alternative Gene Name: FLJ33876, FLJ33951
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004668: 69%, ENSRNOG00000025645: 67%
Entrez Gene ID: 154664
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV
• Gene Sequence: DWLPLNQTFSQVSELVLNVTISTLTFLQQHGVAVTEPVYHLSMQNIVWDPQKVQYDLKSQFGFDDLHTEQILNSSAELKEIPTDTSLEKMVCSV
• Gene ID - Mouse: ENSMUSG00000004668
• Gene ID - Rat: ENSRNOG00000025645
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti ABCA13 pAb (ATL-HPA063601) – 1 Found

Nakato, Mitsuhiro; Shiranaga, Naoko; Tomioka, Maiko; Watanabe, Hitomi; Kurisu, Junko; Kengaku, Mineko; Komura, Naoko; Ando, Hiromune; Kimura, Yasuhisa; Kioka, Noriyuki; Ueda, Kazumitsu. ABCA13 dysfunction associated with psychiatric disorders causes impaired cholesterol trafficking. The Journal Of Biological Chemistry. 2021;296( 33478937):100166.