Protein Description: alpha 1,4-galactosyltransferase
Gene Name: A4GALT
Alternative Gene Name: A14GALT, Gb3S, P(k)
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047878: 64%, ENSRNOG00000009736: 66%
Entrez Gene ID: 53947
Uniprot ID: Q9NPC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: A4GALT
Alternative Gene Name: A14GALT, Gb3S, P(k)
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047878: 64%, ENSRNOG00000009736: 66%
Entrez Gene ID: 53947
Uniprot ID: Q9NPC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD |
Documents & Links for Anti A4GALT pAb (ATL-HPA076542) | |
Datasheet | Anti A4GALT pAb (ATL-HPA076542) Datasheet (External Link) |
Vendor Page | Anti A4GALT pAb (ATL-HPA076542) at Atlas |
Documents & Links for Anti A4GALT pAb (ATL-HPA076542) | |
Datasheet | Anti A4GALT pAb (ATL-HPA076542) Datasheet (External Link) |
Vendor Page | Anti A4GALT pAb (ATL-HPA076542) |