Anti A4GALT pAb (ATL-HPA076542)

Catalog No:
ATL-HPA076542-25
$303.00

Description

Product Description

Protein Description: alpha 1,4-galactosyltransferase
Gene Name: A4GALT
Alternative Gene Name: A14GALT, Gb3S, P(k)
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047878: 64%, ENSRNOG00000009736: 66%
Entrez Gene ID: 53947
Uniprot ID: Q9NPC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD
Gene Sequence EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD
Gene ID - Mouse ENSMUSG00000047878
Gene ID - Rat ENSRNOG00000009736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti A4GALT pAb (ATL-HPA076542)
Datasheet Anti A4GALT pAb (ATL-HPA076542) Datasheet (External Link)
Vendor Page Anti A4GALT pAb (ATL-HPA076542) at Atlas Antibodies

Documents & Links for Anti A4GALT pAb (ATL-HPA076542)
Datasheet Anti A4GALT pAb (ATL-HPA076542) Datasheet (External Link)
Vendor Page Anti A4GALT pAb (ATL-HPA076542)

Product Description

Protein Description: alpha 1,4-galactosyltransferase
Gene Name: A4GALT
Alternative Gene Name: A14GALT, Gb3S, P(k)
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047878: 64%, ENSRNOG00000009736: 66%
Entrez Gene ID: 53947
Uniprot ID: Q9NPC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD
Gene Sequence EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD
Gene ID - Mouse ENSMUSG00000047878
Gene ID - Rat ENSRNOG00000009736
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti A4GALT pAb (ATL-HPA076542)
Datasheet Anti A4GALT pAb (ATL-HPA076542) Datasheet (External Link)
Vendor Page Anti A4GALT pAb (ATL-HPA076542) at Atlas Antibodies

Documents & Links for Anti A4GALT pAb (ATL-HPA076542)
Datasheet Anti A4GALT pAb (ATL-HPA076542) Datasheet (External Link)
Vendor Page Anti A4GALT pAb (ATL-HPA076542)