Amyloid Beta Peptide 40

Cosmo Bio LTD

Catalog No: CSR-KN-TOYU-M03

Visit our Neurodegeneration Products homepage to browse related research products

Click here for the Neuroscience Products Dashboard Page

Recombinant Protein / Amyloid beta peptide 40 (A Beta40)

Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Warning: Store at 4°C. After reconstituted, store no longer than 1-2 days at 4°C, unless preservative is added.For long term storage, aliquot and store reconstituted product frozen at -20°C or lower. Aliquot to avoid cycles of freeze/thaw.